Protein Info for MIT1002_00862 in Alteromonas macleodii MIT1002

Annotation: D-erythrose-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00044: Gp_dh_N" amino acids 2 to 104 (103 residues), 122.7 bits, see alignment E=7.1e-40 TIGR01532: erythrose-4-phosphate dehydrogenase" amino acids 4 to 327 (324 residues), 549.9 bits, see alignment E=1.1e-169 PF02800: Gp_dh_C" amino acids 159 to 315 (157 residues), 192.4 bits, see alignment E=4e-61

Best Hits

Swiss-Prot: 98% identical to E4PD_ALTMD: D-erythrose-4-phosphate dehydrogenase (epd) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K03472, D-erythrose 4-phosphate dehydrogenase [EC: 1.2.1.72] (inferred from 98% identity to amc:MADE_03159)

MetaCyc: 66% identical to D-erythrose-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Erythrose-4-phosphate dehydrogenase. [EC: 1.2.1.72]

Predicted SEED Role

"D-erythrose-4-phosphate dehydrogenase (EC 1.2.1.72)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.2.1.72)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>MIT1002_00862 D-erythrose-4-phosphate dehydrogenase (Alteromonas macleodii MIT1002)
MVNIAINGFGRIGRNVLRALYESGRNNEFNVVAINDIAKPEGIAHLLKYDTAHGRFRFDV
ALKNNTLNVAGDDITLLAISDIKDLPWKDLSVDIVLECTGKFDDRASGQAHLDAGAGKVL
FSSPGSPDLDNTVIFGTNEDTLTSEQKLVSNGSCTTNCIVPVIQALDAAFGVESGTITTI
HASMHDQQVIDAYHEDLRRTRAASQSIIPVDTRLAAGIERILPKFAGKFEAIAVRVPTIN
VTAMDLSVTLQSKVTIEQVNQALRNAKAGRLQGILDYTEEPLVSVDFNHDPHSCIVDGTQ
TRVSHKQLVKTLVWCDNEWGFANRMLDTAKVMFDAK