Protein Info for MIT1002_00846 in Alteromonas macleodii MIT1002
Annotation: Major NAD(P)H-flavin oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to FRA1_ALIFS: Major NAD(P)H-flavin oxidoreductase from Aliivibrio fischeri
KEGG orthology group: K10679, nitroreductase / dihydropteridine reductase [EC: 1.-.-.- 1.5.1.34] (inferred from 86% identity to alt:ambt_03095)Predicted SEED Role
"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)
MetaCyc Pathways
- superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
- pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
- superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
- taxadiene biosynthesis (engineered) (11/13 steps found)
- methylerythritol phosphate pathway I (8/9 steps found)
- methylerythritol phosphate pathway II (8/9 steps found)
- superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
- L-phenylalanine degradation V (3/3 steps found)
- isoprene biosynthesis I (8/10 steps found)
- thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
- tetrahydropteridine recycling (2/2 steps found)
- thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
- superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
- superpathway of ergosterol biosynthesis II (10/26 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Folate biosynthesis
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Terpenoid biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-, 2.2.1.7
Use Curated BLAST to search for 1.-.-.- or 1.5.1.34 or 2.2.1.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (218 amino acids)
>MIT1002_00846 Major NAD(P)H-flavin oxidoreductase (Alteromonas macleodii MIT1002) MSHPIIEDLNKRYTVKQYDASKRISADDLATILEALRLSASSINSQPWKFVVVESDEAKQ RLHDSFANKHQFNQHHAKEASHTILFAYDPKFTKEKFVKRVDAEVASGHLPEDMRENFMG AYAFAEANTDENGNNAAWTKAQVYLALGNVLHTLARLGIASTPMEGVDAELLGEQFKDEL DGHVCEVALAMGYPDTEQDWNHGLPKARLAKEDVIAVV