Protein Info for MIT1002_00835 in Alteromonas macleodii MIT1002

Annotation: putative phospholipid ABC transporter permease protein MlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 72 (28 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 145 to 169 (25 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 5 to 256 (252 residues), 314.7 bits, see alignment E=2.8e-98 PF02405: MlaE" amino acids 42 to 253 (212 residues), 252.4 bits, see alignment E=1.8e-79

Best Hits

Swiss-Prot: 69% identical to MLAE_HAEIN: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 97% identity to amc:MADE_03185)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>MIT1002_00835 putative phospholipid ABC transporter permease protein MlaE (Alteromonas macleodii MIT1002)
MKFFQSIGAKTIGKVTAVGRAALMLFGALIAVPRLKNVPLVIKQLYVVGVQSLLIIMVSG
LFIGMVMALQGYTILVDYGAEGSLGPMVALSLLRELGPVVTALLFAGRAGSALTAEIGLM
KATEQLSSLEMMAVDPLRRIVAPRFWAGMLAMPMLAIIFSAIGILGGHLVGVDWLGVDAG
SYWSIMQSTVDWNQDVINGVIKSLVFALVVTWIAIFKGYDSIPTSEGISKATTETVVYSS
LAVLGLDFVLTALMFGIE