Protein Info for MIT1002_00831 in Alteromonas macleodii MIT1002

Annotation: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR01670: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family" amino acids 20 to 171 (152 residues), 159.8 bits, see alignment E=2.4e-51 PF13419: HAD_2" amino acids 56 to 136 (81 residues), 24.1 bits, see alignment E=7.1e-09 PF08282: Hydrolase_3" amino acids 86 to 152 (67 residues), 42.5 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 45% identical to KDSC_ECOBD: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (kdsC) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K03270, 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC: 3.1.3.45] (inferred from 90% identity to amc:MADE_03189)

MetaCyc: 45% identical to 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase monomer (Escherichia coli BL21(DE3))
3-deoxy-manno-octulosonate-8-phosphatase. [EC: 3.1.3.45]

Predicted SEED Role

"3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45)" in subsystem KDO2-Lipid A biosynthesis (EC 3.1.3.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>MIT1002_00831 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (Alteromonas macleodii MIT1002)
MTTTLYTEINDSLFAKLAKIKLLVCDVDGVFSDGRIYLGNDGEELKAFHTRDGYGVKALV
SNGVNVAVITGRRSAIVENRMKALNVAHIIQGEENKADALSDLMKRLELNTDEVAAVGDD
MPDTGMYKHVAVKIAVADAHPYVAKQVNWITTLPGGFGAVREISDTILQAKGVANEIFGA
SV