Protein Info for MIT1002_00782 in Alteromonas macleodii MIT1002

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 6 to 324 (319 residues), 416.3 bits, see alignment E=4.8e-129 PF04166: PdxA" amino acids 33 to 320 (288 residues), 364.5 bits, see alignment E=2.1e-113

Best Hits

Swiss-Prot: 68% identical to PDXA_PSEA6: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 94% identity to amc:MADE_03413)

MetaCyc: 63% identical to 4-hydroxythreonine-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
4-hydroxythreonine-4-phosphate dehydrogenase. [EC: 1.1.1.262]

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>MIT1002_00782 4-hydroxythreonine-4-phosphate dehydrogenase (Alteromonas macleodii MIT1002)
MSTPIKIAITPGEPAGIGPDLIIKLAQEAWRAQLVVFADGEMLKARASALGLPLTLIDYD
ATNPQIQDAGSLFIKQIDKSVDVTPGELDSENGLYVVETLRQACQANMDGDFDAVVTGPV
HKGIINKAGVSFSGHTEFFAYQSNTIDVVMLLATEGLNVALATTHIPLEYVAKAITRERL
HKVIHIINTDLKLKFGVKEPHIYVCGLNPHAGEDGHIGTEEIHTIIPALNELREEGLKIT
GPLPADTIFQPKYLENADVVLAMYHDQGLPVLKYKGFGASVNITLGLPFVRTSVDHGTAL
DLAGTGEADAGSFRKALEKAIELAHHQQ