Protein Info for MIT1002_00743 in Alteromonas macleodii MIT1002

Annotation: Undecaprenyl-diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details PF02673: BacA" amino acids 7 to 259 (253 residues), 282.8 bits, see alignment E=1.6e-88 TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 7 to 257 (251 residues), 247 bits, see alignment E=1.2e-77

Best Hits

Swiss-Prot: 98% identical to UPPP_ALTMD: Undecaprenyl-diphosphatase (uppP) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 98% identity to amc:MADE_03448)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>MIT1002_00743 Undecaprenyl-diphosphatase (Alteromonas macleodii MIT1002)
MTLFEIIILAIIQGVTEFLPISSSGHLLLPAELFGWVSQGLAFDVAVHVGSLLAVMIYFR
QEIGQMTVAWVTQGFSKQQSTDSKLAWYVIVATIPAVIIGFLMKGWIEENARTALVIAGT
TIIFGLLLWYADATAKREQELEGLTLKQAIYIGLAQVLALIPGTSRSGITMTAGLMLGLK
REACARFSFLLSIPVILGAGLLATLDLLNANEAVDWYALLYGAAFSFVSAYLCIYLFLSW
ISRIGMLPFVIYRLALGVILLWFVFA