Protein Info for MIT1002_00697 in Alteromonas macleodii MIT1002

Annotation: Bicarbonate transporter BicA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 20 to 54 (35 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 373 to 404 (32 residues), see Phobius details PF00916: Sulfate_transp" amino acids 13 to 377 (365 residues), 193.3 bits, see alignment E=8.6e-61 PF00860: Xan_ur_permease" amino acids 57 to 378 (322 residues), 44 bits, see alignment E=2e-15 PF01740: STAS" amino acids 418 to 507 (90 residues), 45.8 bits, see alignment E=6.9e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to amc:MADE_03661)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>MIT1002_00697 Bicarbonate transporter BicA (Alteromonas macleodii MIT1002)
MFDLITSKDSNVKNDVLSGITVALALVPEAVAFAFVAGVEPMIGLYAAFMMGLITSAIGG
RPGMISGATGAMAVVMVALVAQHGVQYLFAAVILAGLLQIMCGIFKLGKFIRLVPYPVML
GFVNGLAIVIFLAQLGQFKVTNAAGELQWMEGTLLYWMLGLVALTMAIIYLLPKLTKAVP
ASLVAIVTVTLLVHGLDLEARTVIDFVRDLLPADQRDTATLAGELPSFAIPMVPFTWETF
MIILPTSVILCLVGLIESLLTLSLIDEMTDTRGRGNKECVGQGVANTVNGFFGGMGGCAM
IGQSMININSGGRGRLSGITAAVVLLGFILFAAPLIEMIPLAALVGVMFVVVIATFEWAS
FRIIRGVNKEDAFVLFLVTGVTVIADLAIAVVVGVIVSALVFAWKHARHIEARSHIDNDG
WKVYELDGPLFFGSVSHFKDLFDIANDPNDVVIDFKDSRIWDSSGIDALDTLADKYEEQG
KKLHIRHISDECRSLLRKADKFVEINVVEDPRYRVATDKLA