Protein Info for MIT1002_00687 in Alteromonas macleodii MIT1002

Annotation: ribosomal-protein-S5-alanine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 13 to 150 (138 residues), 81.6 bits, E=9.1e-27
• PF00583: Acetyltransf_1
  • amino acids 64 to 149 (86 residues), 37.2 bits, E=3.1e-13

Best Hits

KEGG orthology group: None (inferred from 79% identity to amc:MADE_03674)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• L-ornithine biosynthesis I (4/5 steps found)
• superpathway of arginine and polyamine biosynthesis (9/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Protein Sequence (172 amino acids)

>MIT1002_00687 ribosomal-protein-S5-alanine N-acetyltransferase (Alteromonas macleodii MIT1002)
MNTNTAIFTNDKITLRPLTFDDKHWVLALQQDPLWLRYIGSKNVDTVDDACDYIGKTNAQ
REEWGYGLLAVELTETKQPLGVCGLFNRFAFECPDLGFAMLPEARGKGICYEACQCVIAW
SASEGYRFLTAMTHPENMASQKLLQRLGFNKQGFYFDKTFPKQHLFRLELQP