Protein Info for MIT1002_00682 in Alteromonas macleodii MIT1002

Annotation: Elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00038: translation elongation factor P
  • amino acids 4 to 187 (184 residues), 261.2 bits, E=2.3e-82
• PF08207: EFP_N
  • amino acids 5 to 62 (58 residues), 86.9 bits, E=1.1e-28
• PF01132: EFP
  • amino acids 71 to 123 (53 residues), 78.5 bits, E=4.5e-26
• PF09285: Elong-fact-P_C
  • amino acids 131 to 186 (56 residues), 92.4 bits, E=1.6e-30

Best Hits

Swiss-Prot: 89% identical to EFP_PSEHT: Elongation factor P (efp) from Pseudoalteromonas haloplanktis (strain TAC 125)

KEGG orthology group: K02356, elongation factor P (inferred from 99% identity to amc:MADE_03678)

MetaCyc: 71% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Protein Sequence (189 amino acids)

>MIT1002_00682 Elongation factor P (Alteromonas macleodii MIT1002)
MANYSTNEFKGGLKIMLDGEPCNILENEYVKPGKGQAFNRVKIRKLISGKVLEKTFRSGE
SVEGADVMDTELAYLYTDGEFYHFMNNDTFEQIAADEKAVGENKKWLVENDVCTITLWNG
SPITVTPPNFVELEITETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEVIRVDTRS
GEYVSRAQK