Protein Info for MIT1002_00681 in Alteromonas macleodii MIT1002

Annotation: L-lysine 2,3-aminomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR00238: KamA family protein" amino acids 3 to 328 (326 residues), 368 bits, see alignment E=4e-114 TIGR03821: EF-P beta-lysylation protein EpmB" amino acids 16 to 335 (320 residues), 483.2 bits, see alignment E=3.2e-149 PF13353: Fer4_12" amino acids 111 to 182 (72 residues), 28 bits, see alignment E=2.5e-10 PF04055: Radical_SAM" amino acids 118 to 204 (87 residues), 41.4 bits, see alignment E=1.8e-14

Best Hits

Swiss-Prot: 57% identical to EPMB_ECOLI: L-lysine 2,3-aminomutase (epmB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to amc:MADE_03679)

MetaCyc: 57% identical to lysine 2,3-aminomutase (Escherichia coli K-12 substr. MG1655)
5.4.3.-

Predicted SEED Role

"Lysyl-lysine 2,3-aminomutase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>MIT1002_00681 L-lysine 2,3-aminomutase (Alteromonas macleodii MIT1002)
MEQIIPKKPISVEHNWQKELASSFTDPAKLLQHLGLDQEKYAQHIKARRLFPMRVPRHFV
DLMEKENPNDPLFLQVMPLSDEFLTSPGYSKDPLDEHDTAGKGILHKYDSRVLLMVRTGC
AVNCRYCFRRHFPYADNAVSKHQWLDVLEYLRSNNKINEVIFSGGDPLMAKDDHLSWLAN
EIAAIPHIKRLRIHSRLPVVLPERISHDFVEWFTALPLQKVLVLHANHANEMSETLKSRL
NTLRERGVILLNQSVLLKGVNDSGDAISDLSETLFEAGVLPYYLHVLDKVQGASHFYVSD
DEGRRIMKEAIKRLPGFLVPKLVREIGGQPGKTPIDLHLHP