Protein Info for MIT1002_00649 in Alteromonas macleodii MIT1002

Annotation: Sulfite exporter TauE/SafE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 5 to 14 (10 residues), see Phobius details transmembrane" amino acids 15 to 45 (31 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details PF01925: TauE" amino acids 12 to 263 (252 residues), 169 bits, see alignment E=7.1e-54

Best Hits

KEGG orthology group: None (inferred from 91% identity to amc:MADE_03708)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>MIT1002_00649 Sulfite exporter TauE/SafE (Alteromonas macleodii MIT1002)
MEPLVVIVLSCLILGSVVGVLAGMLGIGGGLIIVPVLSYLLIHFMGMTTETVMPVAIATS
LSTIIFTGMSSAFAHYKLGNIQRHVVLYTGLGIAFGAFAGAQIASHISGELLKDVFAVLV
ILIAMQMIFGKQKASENDASKGTLATVGGGAGLLSALMGIGGGALLVPALVWFRVNVRAA
IGCAAFCGLIIAVFGTTSFIVAGYNAIDVPEHSLGYVYLPATAGIVATSMFTANIGAKLG
QRVNVRVLKAMLACLLVLVSIRMILGIE