Protein Info for MIT1002_00629 in Alteromonas macleodii MIT1002

Annotation: tRNA pseudouridine synthase D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01142: TruD
  • amino acids 11 to 173 (163 residues), 137.9 bits, E=2.2e-44
  • amino acids 199 to 350 (152 residues), 74 bits, E=5.6e-25
• TIGR00094: tRNA pseudouridine synthase, TruD family
  • amino acids 15 to 245 (231 residues), 199.2 bits, E=7.7e-63

Best Hits

Swiss-Prot: 50% identical to TRUD_PSEA6: tRNA pseudouridine synthase D (truD) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K06176, tRNA pseudouridine synthase D [EC: 5.4.99.12] (inferred from 92% identity to amc:MADE_03723)

Predicted SEED Role

"tRNA pseudouridine 13 synthase (EC 4.2.1.-)" in subsystem tRNA processing (EC 4.2.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 5.4.99.12

Use Curated BLAST to search for 4.2.1.- or 5.4.99.12

Protein Sequence (361 amino acids)

>MIT1002_00629 tRNA pseudouridine synthase D (Alteromonas macleodii MIT1002)
MKPLHTDHWQYYFAKPVSTGIFKFQADDFQVVEDLGYTPCGEGEHQFVFIEKTNTNTAFV
AEQLARFVNLPLRQITYAGRKDKYAVTQQWFGIHAPGKPDFDFSNFELEGVKVLKQMRHN
KKLRTGQLKGNHFTITLRQVLHPEAIEERLQEIEKHGVPNYYGEQRFGVMRLNDMGEVQR
GGNLVMAERMVNGETIRHRNKRSMALSALRSWLFNEMLSARLEKDMFDKVTHGDALVLSG
SNSFFINEGSDGSEQQQDAQRRFNAKDVCPSAPLWGKGELVTQADTLALEQSVAEQNSEV
IDFLSQCGFEQERRAIKIWPSQLEWQSKGDTFTISFALPSGCFATSVLRECVETLSPINR
V