Protein Info for MIT1002_00573 in Alteromonas macleodii MIT1002

Annotation: Tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 TIGR02249: integron integrase" amino acids 2 to 315 (314 residues), 465.3 bits, see alignment E=5.3e-144 PF13495: Phage_int_SAM_4" amino acids 2 to 82 (81 residues), 95.6 bits, see alignment E=1.8e-31 PF00589: Phage_integrase" amino acids 100 to 302 (203 residues), 127.4 bits, see alignment E=5.1e-41

Best Hits

KEGG orthology group: None (inferred from 86% identity to alt:ambt_15575)

Predicted SEED Role

"Integron integrase IntI4" in subsystem Integrons

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>MIT1002_00573 Tyrosine recombinase XerD (Alteromonas macleodii MIT1002)
MQMVIEHMHNRRYAKRSIELYSKWIISFIRFNNNRHPSEMGDKEVEVFLSHLVNAKNVAP
ATQASALNALAFLYRDILERPLSCELNFVSSRRQAKLPVVLTQEEVVSLFEQIPANLKLP
ISLLYGSGLRLMEAVRLRVKDIDFDYNAIRIWDGKGGKHRIVTLAAELKPGLTRQIAMVE
NFLAADLENPKYAGVYLPHRLRLKYKNAPRELGWHYLFPSSRLSVDPESKRVRRHHIDES
SIQKAIRNTAKTCDIKKKVTPHTLRHSFATHLLQSGADIRTVQTQLGHSDVKTTQIYTHV
LQQGAQGVVSPLSRVLK