Protein Info for MIT1002_00568 in Alteromonas macleodii MIT1002

Annotation: Group II intron-encoded protein LtrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR04416: group II intron reverse transcriptase/maturase" amino acids 36 to 382 (347 residues), 401.7 bits, see alignment E=1.4e-124 PF00078: RVT_1" amino acids 93 to 305 (213 residues), 139.7 bits, see alignment E=1.1e-44 PF08388: GIIM" amino acids 318 to 395 (78 residues), 62.2 bits, see alignment E=3.8e-21

Best Hits

KEGG orthology group: K00986, RNA-directed DNA polymerase [EC: 2.7.7.49] (inferred from 71% identity to sbm:Shew185_2180)

Predicted SEED Role

"Mobile element protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.49

Use Curated BLAST to search for 2.7.7.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>MIT1002_00568 Group II intron-encoded protein LtrA (Alteromonas macleodii MIT1002)
MSDLNTRMPSGSDVTQRTDEQPAFSADLLELFLQPSNLVSAWKQVRANKGAAGMDGMTID
DFPAWANAGNWKRVMTELRSGQYQPSPVKRVEIDKPDGGKRQLGIPTIVDRVIQQAIAQV
LTPIFDPTFSDNSFGFRPHRNGQQAVKQVNSIIKTGRRFAVDVDLSKFFDRVNHDLLMTY
LGYKVKDKRLLKLIKRYLRAGILCKTKGDNQLYSESREGVPQGGPLSPLLANIMLDPLDK
ELEKRGHEFARYADDFTILVKTPRSGERVLNSISRFLCHRLKLVVNTTKSHVVKTSESKF
LGFTFKAGRIQWHPKTLMKFKQQVRRLTNRNWGVSMQYQLFKLSQYLRGWINYFGIASGY
QRCVELDHWIRRRVRMAYWRQWRKPRTKVRHLMRLGVHVQAAVACGITSKGPWRSAKSPG
INQALSLDYLKSEGLYSLRDGWVALHYPK