Protein Info for MIT1002_00555 in Alteromonas macleodii MIT1002

Annotation: putative alkylphosphonate utilization operon protein PhnA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00686: putative alkylphosphonate utilization operon protein PhnA
  • amino acids 2 to 109 (108 residues), 124.1 bits, E=1.4e-40
• PF08274: YjdM_Zn_Ribbon
  • amino acids 2 to 31 (30 residues), 57.7 bits, E=9.2e-20
• PF03831: YjdM
  • amino acids 42 to 109 (68 residues), 86.8 bits, E=7e-29

Best Hits

Swiss-Prot: 54% identical to YJDM_ECO57: Protein YjdM (yjdM) from Escherichia coli O157:H7

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 98% identity to amc:MADE_00604)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• phosphonoacetate degradation (1/1 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Protein Sequence (109 amino acids)

>MIT1002_00555 putative alkylphosphonate utilization operon protein PhnA (Alteromonas macleodii MIT1002)
MSLPPCPHCQSEYVYEDQPLLICPECGHEWNPNEVEEEVSAKDFNGTPLVAGDKITLAKD
LKVKGSSLVLKIGTKAVIRHVKDAKDHQLDCKVDGAGEMMLTAQFVKKA