Protein Info for MIT1002_00551 in Alteromonas macleodii MIT1002

Annotation: Mn2+ and Fe2+ transporters of the NRAMP family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 48 to 69 (22 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 119 to 121 (3 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 192 to 219 (28 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 90% identity to amc:MADE_00602)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>MIT1002_00551 Mn2+ and Fe2+ transporters of the NRAMP family protein (Alteromonas macleodii MIT1002)
MSYSAETAFFARCIALLKLLGPGVLMATAAVGGSHLVASTQAGAKFGWQLALLILVVNLL
KYPFFRAGVSYTISTKQTLQQGYLGMGRRYLAIALGLNTIASVVNAAALLLFAASLLSYF
IPFDIAITLSASVVLALILIILLAGHFEGLDNIAKGIMGVLVVATVAVFVVALSNYSASP
APAVAPPSPWTLATLGFLVVTMGWMPAPIEISSITSLWLKRQCKGQAVTPKSALFDFNLG
YAVTVLLALLFLGLGALILYGSGTELSTSGIGFSHQLISMYSSTIGQWAHWLIALVAFLC
IFGSALTVYDGYARVVAEAIALLFNKDKNARNTLVTPVLLFMAVASFIIVLFFKSALLAM
LGFAMTLAFVTTPMFAWLNHKLVAQTKLHQDAAPNVIVKLLSYLGLIYLFGFLMVFIWWK
WFS