Protein Info for MIT1002_00544 in Alteromonas macleodii MIT1002

Annotation: Alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 3 to 354 (352 residues), 341.9 bits, E=2.1e-106
• PF01168: Ala_racemase_N
  • amino acids 9 to 217 (209 residues), 195.5 bits, E=1.1e-61
• PF00842: Ala_racemase_C
  • amino acids 232 to 354 (123 residues), 162.1 bits, E=4.8e-52

Best Hits

Swiss-Prot: 90% identical to ALR_ALTMD: Alanine racemase (alr) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 90% identity to amc:MADE_00596)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• alanine racemization (1/1 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• L-alanine degradation I (1/2 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• D-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1

Protein Sequence (358 amino acids)

>MIT1002_00544 Alanine racemase (Alteromonas macleodii MIT1002)
MSRQTQAIIHADALLHNFKALAALAPSSQSMAVVKADAYGHGAVNVARILQHVSSRFAVA
IIEEAIALRDAGISAPIVVLEGAHQAKECQMAFQHNCILVMHCEEQLTWLESCPEQQRPH
IWLKVDSGMHRLGFALSDIEGITAKYNHLLSEQTVIATHFACADDVDNNFTNTQIDAFNQ
VASKLDLPTSVANSPATVNWPASRNAWNRLGVGVYGGAVSTSQNLDIEIYPAMTLRSSVL
AVRTIPAGEGIGYGQTWVASKPSKIATVGIGYADGYPRHCKNGTPVMIRGKRAYLAGRVS
MDMITIDVTHIDNVAVGDEVELWGQNVPIQEVAANADTIDYELMTRVSQRVPRIVKYL