Protein Info for MIT1002_00518 in Alteromonas macleodii MIT1002

Annotation: putative hydrolase YxeP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01891: amidohydrolase
  • amino acids 38 to 417 (380 residues), 361.5 bits, E=2.7e-112
• PF01546: Peptidase_M20
  • amino acids 95 to 424 (330 residues), 135 bits, E=3.5e-43
• PF07687: M20_dimer
  • amino acids 223 to 317 (95 residues), 46.1 bits, E=4.1e-16

Best Hits

Swiss-Prot: 38% identical to YHAA_BACSU: Putative amidohydrolase YhaA (yhaA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01436, amidohydrolase [EC: 3.5.1.-] (inferred from 94% identity to amc:MADE_00571)

MetaCyc: 38% identical to N-acetyl amino acid acetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"Peptidase M20D, amidohydrolase (EC 3.5.1.14)" (EC 3.5.1.14)

MetaCyc Pathways

• S-(2-succinyl)-L-cysteine degradation (2/4 steps found)
• S-benzyl-L-cysteine degradation (1/5 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.14

Protein Sequence (432 amino acids)

>MIT1002_00518 putative hydrolase YxeP (Alteromonas macleodii MIT1002)
MYQKLLSLAFAGLASVSAANAAQINVDELANKVEPDVIKWRHHFHEFPELSNREFKTAEY
VADYLESLGLEVQTGVAKTGVVAILDSGKPGPVVALRADMDGLPVKEQNDLSYRSKQMGE
YNGKEVPVMHACGHDTHMAMLMGAAKILTEIKGDLKGKVKFIFQPAEEGAPAGEKGGAEV
MVAEGVLKNPDVDAIFGLHINANTDVGKVRYNAGGTMAAVDPFKIVIHGKQAHGAYPWKS
VDPVVTAAQMIMSIQTIVSRELKLIDDAAVVSIGSIHGGNRSNIIPNKVEMVGTIRTLNE
AARDHIYESLPRKVKAIAESMGAEAELTLPLDYYYPITYNDPELTKAMLPTMQRTAGVEN
TLLSKPVTGAEDFSFFQEQIPGLYVWVGGKPLDVSEEDSPAHHTPEFNVDDEGMKLGVKL
LTNFTLDYMAQH