Protein Info for MIT1002_00486 in Alteromonas macleodii MIT1002

Annotation: Protein-export protein SecB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02556: SecB
  • amino acids 17 to 155 (139 residues), 195.9 bits, E=1.5e-62
• TIGR00809: protein-export chaperone SecB
  • amino acids 19 to 155 (137 residues), 200.6 bits, E=5.1e-64

Best Hits

Swiss-Prot: 99% identical to SECB_ALTMD: Protein-export protein SecB (secB) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 99% identity to amc:MADE_00541)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Protein Sequence (169 amino acids)

>MIT1002_00486 Protein-export protein SecB (Alteromonas macleodii MIT1002)
MADENQTNNGEAAGAQAQQSAQFNIQRIYTKDISFESPNAPAIFTKEWKPEIKLDIDTST
NKLEENVFEVVLSVTVTATLGEETAFLCEVQQAGIFAIGEMPDQNKAHTLGSFCPNMLFP
YARETISNLVNRGTFPPLNLAPVNFDAIFAAYVQKRAQQAQGEAPKMDA