Protein Info for MIT1002_00482 in Alteromonas macleodii MIT1002

Annotation: Macrolide export ATP-binding/permease protein MacB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 transmembrane" amino acids 258 to 275 (18 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 532 to 556 (25 residues), see Phobius details amino acids 586 to 611 (26 residues), see Phobius details amino acids 619 to 639 (21 residues), see Phobius details PF00005: ABC_tran" amino acids 23 to 171 (149 residues), 109.8 bits, see alignment E=2.6e-35 PF12704: MacB_PCD" amino acids 282 to 500 (219 residues), 168.7 bits, see alignment E=3.3e-53 PF02687: FtsX" amino acids 537 to 649 (113 residues), 75.8 bits, see alignment E=4.6e-25

Best Hits

Predicted SEED Role

"Macrolide export ATP-binding/permease protein MacB (EC 3.6.3.-)" in subsystem Multidrug Resistance Efflux Pumps (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (656 amino acids)

>MIT1002_00482 Macrolide export ATP-binding/permease protein MacB (Alteromonas macleodii MIT1002)
MSLIQLNGVSRRYKTEGFEVTALDNVSLSIDKGEFVAIMGQSGSGKSTLMNILGCLDTPS
EGEYRIHGQSVSSLNPDQLSALRLKTFGFVFQRYQLLSSLNATENVALPAIYSGTPSEDR
TLKAQQLLDKLGLSSRKEHKPGELSGGQQQRVSVARALINGAEVILADEPTGALDSASGE
QLLALLRELHAEGVTIILITHDSAVAEHADRQIHLLDGKIVTDTKSAPRSQGESVEKNAA
SVQHAHAQERNSEPAIKPFPSISLFSALSMAFTALRMNWFRTLLTLLGIIIGVAAVVTMM
AIGEGGKQQVLERIETIGTNLISIRPGGRNMRSSGDIASLTLADATALKSVPGVAYVAPE
RSARATIRYSENDFSGRITGTTPDYFHAKDWEMAQGVFFSDEDVTNYAPVVVIGDTVAET
LFEDKYRAVGEYILMQNAFYQVVGVLHSKGASAGGNDMDDEVLIPVTTGRLKVFGRDYLS
SITIKAESTEVATQVKDDVLALLVERHGQEDVMVRTTESLVEAVTETQDTLTWLLASVAA
ISLFVGGIGVMNIMLVNVSERKREIGLRIATGAKPRDILRQFNIEAWVVCILGGIFGILL
GYFVVLIVASFSVPVAYTLMPPVLAFVTSLAVGLIFGYAPAQKASKLNPIDALAEE