Protein Info for MIT1002_00481 in Alteromonas macleodii MIT1002

Annotation: Macrolide-specific efflux protein MacA precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 61 to 379 (319 residues), 172.5 bits, see alignment E=5.5e-55 PF25917: BSH_RND" amino acids 79 to 234 (156 residues), 60.8 bits, see alignment E=1.9e-20 PF00364: Biotin_lipoyl" amino acids 80 to 111 (32 residues), 22.2 bits, see alignment (E = 2.1e-08) PF25967: RND-MFP_C" amino acids 325 to 380 (56 residues), 34.8 bits, see alignment 2.6e-12

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 48% identity to pla:Plav_1101)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>MIT1002_00481 Macrolide-specific efflux protein MacA precursor (Alteromonas macleodii MIT1002)
MANLYIRYIAFSFFYGSNALKLPLPIKVLLIAIIVFVPAYAVYAWLYSPQTNTEYLFQDA
KIRDIELNLVSTGQLEPKRYVEVGAQVSGQVDNIHVEEGDIVKEGDLLVEIDARVFETQV
QNSQAALDSKKAQLAQLRAERELAEVRAQRNQNLFKQNAVSQDVVVSSDTNLKVIDTKIT
ASIAQIKADEASLEGDITKLGFAKIFAPISGTVATLPVREGQTLNANQNAPVLLQISDLS
VMTLRAEVSEADVQKIKRGMPVYFSTLGDNKTFYHSTVRQVLPTPTVLNDVVLYQVLIDV
ENPERTLMDAMTTQVFFVQEQEKGALSVPLAAVKGRARNQFVMLKQGDEVVRTPVKVGIK
NRTHIQIIEGLSEGDEVVVGLADGTAMPAAGMRRVPGGQPPSGPPRRRDGF