Protein Info for MIT1002_00383 in Alteromonas macleodii MIT1002

Annotation: 30S ribosomal protein S10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01049: ribosomal protein uS10
  • amino acids 4 to 101 (98 residues), 155.3 bits, E=2.1e-50
• PF00338: Ribosomal_S10
  • amino acids 7 to 100 (94 residues), 127.2 bits, E=1.3e-41

Best Hits

Swiss-Prot: 100% identical to RS10_ALTMD: 30S ribosomal protein S10 (rpsJ) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K02946, small subunit ribosomal protein S10 (inferred from 98% identity to pat:Patl_0468)

MetaCyc: 92% identical to 30S ribosomal subunit protein S10 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S10p (S20e)" in subsystem Ribosome SSU bacterial

Protein Sequence (103 amino acids)

>MIT1002_00383 30S ribosomal protein S10 (Alteromonas macleodii MIT1002)
MPNQRIRIRLKAFDHKLIDQSTAEIVETAKRTGAQVSGPIPLPTRKERYTVLISPHVNKD
ARDQYEIRTHKRLVDIIEPTDKTVDALMRLDLAAGVDVQISLG