Protein Info for MIT1002_00378 in Alteromonas macleodii MIT1002

Annotation: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR01258: phosphoglycerate mutase 1 family" amino acids 3 to 246 (244 residues), 396.2 bits, see alignment E=2.6e-123 PF00300: His_Phos_1" amino acids 4 to 126 (123 residues), 110.3 bits, see alignment E=5.1e-36 amino acids 130 to 209 (80 residues), 22.5 bits, see alignment E=4e-09

Best Hits

Swiss-Prot: 100% identical to GPMA_ALTMD: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA1) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 100% identity to amc:MADE_00439)

MetaCyc: 66% identical to 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Escherichia coli K-12 substr. MG1655)
RXN-15513 [EC: 5.4.2.11]

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.1 or 5.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>MIT1002_00378 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Alteromonas macleodii MIT1002)
MYKLVLIRHGESQWNLENRFTGWHDVDLTDTGVAQAKTAGQLLKDAGFTFDQAYTSVLLR
AIKTLNIALEEMGQHYLPVERHWRLNERHYGALTGLDKAETAAKHGEEQVKIWRRSFDIP
PPAVEDDSEHFPGHDPRYNNVDADILPRGESLKLTIERVLPYWHDVIRPDIQAGKRVIIA
AHGNSLRALVKYLDGMSDEEVLGLNIPTGVPLVYELDENLKPISKEYLGDADAIKAMMDA
VAKQGKAK