Protein Info for MIT1002_00355 in Alteromonas macleodii MIT1002

Annotation: putative permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details PF00892: EamA" amino acids 1 to 130 (130 residues), 77.2 bits, see alignment E=7.7e-26 amino acids 148 to 290 (143 residues), 45.6 bits, see alignment E=4.5e-16

Best Hits

KEGG orthology group: None (inferred from 92% identity to amc:MADE_00423)

Predicted SEED Role

"Predicted permease, DMT superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>MIT1002_00355 putative permease, DMT superfamily (Alteromonas macleodii MIT1002)
MGVFAALGTALCWAIAARLFRGTGNAFSPLTMNFWKGLISIAILAVVLVVVQPTGLSTHA
VLWLLLSGLIGIGIGDTCFFKALQSIGDSQAVLVAETLAPLFTALFAMAFIGEWITWQQW
VGVAVVLFSVDMVIKVRKRSTTHVFATSGYLYGVGAALCQAVGAVVSRDILSAGEIDAAS
AAFLRLVGGMVFVVPLIALTKTRYMPVINYESDSGKRVWPAFVLATLLGTTAAIYLQMFA
FAYAKAAVVQTLIATSALMSLGVAWVLGERATKATIVWSAVALVGVAILVSFGSPAH