Protein Info for MIT1002_00333 in Alteromonas macleodii MIT1002

Annotation: Putative protein-S-isoprenylcysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 145 to 173 (29 residues), see Phobius details PF04140: ICMT" amino acids 105 to 186 (82 residues), 29 bits, see alignment E=1.2e-10 PF04191: PEMT" amino acids 108 to 190 (83 residues), 26.2 bits, see alignment E=9.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to amc:MADE_00398)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>MIT1002_00333 Putative protein-S-isoprenylcysteine methyltransferase (Alteromonas macleodii MIT1002)
MNDTYDYGLWSMVILNSAIFIFFAFSFVKPKSSTDWRSLGVFSAFIVALFTEMYGFPLTI
YFLSGWLAETYPEVNFFAHENGHLLHTFFGFKGDAHWDPFHIASMVFIVAGFFILSSAWN
VLHHAQKNHHLAKTGWYARCRHPQYLAFILIMFGFLLQWPTIPTLVMFPVLVVVYVKLAK
REEALAIAEFGDEYVSYINTTPGWIPNLNFKLKGESHEKIH