Protein Info for MIT1002_00324 in Alteromonas macleodii MIT1002

Annotation: Putative copper export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 15 to 40 (26 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details PF05425: CopD" amino acids 203 to 299 (97 residues), 68.7 bits, see alignment E=2.7e-23

Best Hits

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 100% identity to amc:MADE_00389)

Predicted SEED Role

"Copper resistance protein CopD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>MIT1002_00324 Putative copper export protein (Alteromonas macleodii MIT1002)
MGDRNGPEHAAVEMYIWNTVIVVSKLMFYLGFAATAGYTFFWRDINDNSTNYTTPSYSAV
WVKVCVFVAFISNAVWFIANTGAMVEEGIQGALDPFMLKIMLSSPIGEVTLYRAGGLAVA
LITIYLLKFKPLKPFLRLKSCLLVLCLFTLSYTFTLTGHVSELGSIARILLMVHVFVMAW
WFGALIPLKLSCHYQSYEKLYKLMDRFGTQAAVLVTLLLSAGIWLAIQLVGSFEGLFSSI
YGQTLLVKMFLVTSILAIAIRHKLKLVPKLKSGSGSEALSKSISLELTIAVAILIITSGL
TSIVGPER