Protein Info for MIT1002_00297 in Alteromonas macleodii MIT1002

Annotation: Cation efflux system protein CzcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 169 to 202 (34 residues), 23.8 bits, see alignment 6.2e-09 PF16576: HlyD_D23" amino acids 203 to 281 (79 residues), 39.2 bits, see alignment E=1e-13 PF13437: HlyD_3" amino acids 210 to 281 (72 residues), 40.3 bits, see alignment E=8.9e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to amc:MADE_00373)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>MIT1002_00297 Cation efflux system protein CzcB (Alteromonas macleodii MIT1002)
MLKQILFLFLIGTVTSIATASEDVTNSNDNQNIFQKGNIKIEVSIDESPEGSVIIASTFE
DGKPFIPDSFSIELQKLGSSSEKFEFQTSEGVLRSIKALSEPHSFRATIYLTDKRRKYSW
EWENFEGRTQISRALTEKFQLATSEVQSGTIERHIELLGTLVIPPKNKAEVNARFSGVVE
TLASDVGDSVKAGDVIAKIQSNDSLQTYIVKAPISGTVVSRNVNVGQLVTSETLYKIVDA
ETLWAELKVFPSKRDTIKQGSYIHIKKGSRQQDAKVKFLIPSGSLEPYQIAIVEITNTEG
EFSPGDMVTGVVDAQKVDVSLRVENEAIQSMDGNSVVFLNDGNTFQAVPVELGIKDDNFT
EVKRGLIAGQIYVSKNSFLIKADLEKSGASHAH