Protein Info for MIT1002_00255 in Alteromonas macleodii MIT1002

Annotation: Putative copper export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details PF05425: CopD" amino acids 198 to 296 (99 residues), 57.3 bits, see alignment E=9e-20

Best Hits

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 97% identity to amc:MADE_00324)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>MIT1002_00255 Putative copper export protein (Alteromonas macleodii MIT1002)
MDIWQLGLLISKFGVYLGVSALLGGGWILCITNTDTDTKFTLPASLQTTVTRHMRLFAVI
GIIFSAFDFLFQVGQLAQSGYAGMFDPVMREMVAHSTLGDVAKSRLVLFASALLYLTYLG
HSIRKNAFISNRSLGIFIVIALAGFGYTFTLTGHTQQLQPSFKFILAAHAVIALAWVGSL
WPLSRTCVALSNPNLHLVMTKFGKSAVYPIGGLIIAGLLLAWQLVRSVSSLLDTNYGFVL
LVKLLFVGAIFLIALLHKLRLAPQLLTGITSPRTLQKSIQIELCIGISILMVTVVLSTAV
GPNY