Protein Info for MIT1002_00239 in Alteromonas macleodii MIT1002

Annotation: A/G-specific adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01084: A/G-specific adenine glycosylase" amino acids 10 to 274 (265 residues), 378.8 bits, see alignment E=8.6e-118 PF00730: HhH-GPD" amino acids 39 to 173 (135 residues), 93.4 bits, see alignment E=2.3e-30 PF00633: HHH" amino acids 104 to 131 (28 residues), 29.7 bits, see alignment (E = 7.9e-11) PF10576: EndIII_4Fe-2S" amino acids 200 to 216 (17 residues), 22.6 bits, see alignment (E = 2.1e-08) PF14815: NUDIX_4" amino acids 243 to 352 (110 residues), 75.2 bits, see alignment E=7.7e-25

Best Hits

Swiss-Prot: 45% identical to MUTY_BUCAI: Adenine DNA glycosylase (mutY) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 92% identity to amc:MADE_00282)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>MIT1002_00239 A/G-specific adenine glycosylase (Alteromonas macleodii MIT1002)
MTEQQYTGSFAERVLAWFDKHGRKHLPWQQDVTPYKVWVSEIMLQQTQVTTVIPYFKRFM
ASFPTVHDLAKASQDDVLHHWTGLGYYARARNLHKAANMLVDNYNGEFPYSLEEVMDLPG
IGRSTAGAILSLSRNMHFPILDGNVKRVLARYYAIGGWPGQKKVENLLWEVAEKNTPTNP
EGGRCANYTQVMMDLGAMICTRSKPKCDECPLQADCIAYAQGTQTDYPGKKPKKTLPEKS
TFMMVAQFNSQVYLEQRPSTGLWGGLYGFIEVSSIEEGIEQLAKRGISVDETRTLEGFRH
TFSHFHLDITPVVAVVNSAPTKRVAEMAFRWFSLNEPIEVGLAAPTTKIIQQLMR