Protein Info for MIT1002_00237 in Alteromonas macleodii MIT1002

Annotation: tRNA (guanine-N(7)-)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 48 to 238 (191 residues), 231 bits, see alignment E=3.9e-73 PF02390: Methyltransf_4" amino acids 64 to 233 (170 residues), 208.2 bits, see alignment E=3.1e-66

Best Hits

Swiss-Prot: 71% identical to TRMB_PSEA6: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K03439, tRNA (guanine-N7-)-methyltransferase [EC: 2.1.1.33] (inferred from 92% identity to amc:MADE_00280)

MetaCyc: 64% identical to tRNA m7G46 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (guanine-N(7)-)-methyltransferase. [EC: 2.1.1.33]

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>MIT1002_00237 tRNA (guanine-N(7)-)-methyltransferase (Alteromonas macleodii MIT1002)
MRQFKSQAEAEAAGVYVSKVKSFVKREGRLTKAQQKALEDHWPTKGIDYAEAPLSLSEIF
GRSAPVVVEIGFGMGKSLVEMAANAPEKDFIGIEVHRPGVGACLAEASEQGVENLRVMDH
DAVEVLKNMIPDGSLSRLQLFFPDPWHKKRHHKRRIVQPEFVELVRTKLAIGGCFHMATD
WEQYAEHMLDVMINADGYTNTATDGDYVPRPDYRPITKFETRGQKLGHGVWDLIFERTK