Protein Info for MIT1002_00235 in Alteromonas macleodii MIT1002

Annotation: Glycogen synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 1 to 471 (471 residues), 523.6 bits, see alignment E=2.3e-161 PF08323: Glyco_transf_5" amino acids 2 to 233 (232 residues), 222.7 bits, see alignment E=1.2e-69 PF13439: Glyco_transf_4" amino acids 115 to 225 (111 residues), 30.6 bits, see alignment E=6.7e-11 PF00534: Glycos_transf_1" amino acids 285 to 434 (150 residues), 55.7 bits, see alignment E=9.4e-19 PF13692: Glyco_trans_1_4" amino acids 292 to 434 (143 residues), 42.7 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 49% identical to GLGA_PHOPR: Glycogen synthase (glgA) from Photobacterium profundum (strain SS9)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 90% identity to amc:MADE_00278)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>MIT1002_00235 Glycogen synthase (Alteromonas macleodii MIT1002)
MNIVFAISEVEELVKTGGLADVGKALPLALDTLGESITIVMPYYQVLAEQLNLPTVTEQQ
TLFTEGQVYHFDIRYMQWHGIPIYFVDSPEYFTREGLYANAFEAYEDNGERFSFFSGAVL
QTLKAIDKKPDIIHCHDWHAAMLPFLLTHDKSGYFDGTKTIFTIHNAAFQGVHKLESIPF
LRHHPNILAQVHGGYINMLQSGIEFATKVTTVSPNYASELLTDLGSHGLHERLVNRQADL
SGILNGCDYTQWNPETDTFLPENYSVENLHPKTACKRALQEKSGLPENVNVPLIGMVCRL
TEQKGFGYILPILDDLIKHNVQMVIVGTGDPKVCMDLGEFAQQHPDQFAFINGFSSEHAH
LVEAGADFFLMPSQFEPCGLNQMYSLAYGTIPIVRSVGGLKDTVIDYSNDSEGTGFVFDE
PTPHALLSCIRRALLAFYEDAGKFRAMQQRGMRTRFTWEAAAKNYQQLYVSTLN