Protein Info for MIT1002_00168 in Alteromonas macleodii MIT1002

Annotation: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01081: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase" amino acids 2 to 447 (446 residues), 757.5 bits, see alignment E=2.8e-232 PF01225: Mur_ligase" amino acids 2 to 95 (94 residues), 70 bits, see alignment E=2.7e-23 PF08245: Mur_ligase_M" amino acids 109 to 289 (181 residues), 72.4 bits, see alignment E=7.7e-24 PF02875: Mur_ligase_C" amino acids 311 to 433 (123 residues), 72.8 bits, see alignment E=7.5e-24

Best Hits

Swiss-Prot: 60% identical to MPL_HAEIN: UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (mpl) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02558, UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC: 6.3.2.-] (inferred from 95% identity to amc:MADE_00213)

MetaCyc: 61% identical to UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (Pseudomonas aeruginosa PAO1)
RXN0-2361 [EC: 6.3.2.45]

Predicted SEED Role

"UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)" (EC 6.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.- or 6.3.2.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>MIT1002_00168 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase (Alteromonas macleodii MIT1002)
MHVHILGICGSFMGGIAAIAKSLGHKVTGSDKNVYPPMSTQLEALGIELTEGYCESQFDP
APDMVVIGNAMSRGNPAVEYVLNRNLPYTSGPQWLLDNLLKDRWVIGLSGTHGKTTTSSM
VAWILEHASLNPGYLIGGVPENFGVSARVGESPFFVIEADEYDSAFFDKRSKFVHYRPKT
LVINNLEFDHADIFADLGAIQTQFHHLVRMVPENGLILTPNNTPAIEDMLKKGCWSSRQS
LGKEWHAELLKKDGSKFNVLHNGVIAGTVTWALVGQHNVDNALMAIAAAHHAGVTLPDAI
DALSFFKNVKRRMEVKGEVNNITLYDDFAHHPTAIATTLDGLRKKVGNARILAVLEPRSN
TMKMGVHKDTLANSWQKADEVYLYEPEGMDWSLVDSVAHSNAPTHCFRDVEKIVQGVCNV
AQPGDHILVMSNGGFEGIHGRILDALKMKSKL