Protein Info for MIT1002_00065 in Alteromonas macleodii MIT1002

Annotation: Thiosulfate sulfurtransferase GlpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 56% identical to GLPE_SHEON: Thiosulfate sulfurtransferase GlpE (glpE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02439, thiosulfate sulfurtransferase [EC: 2.8.1.1] (inferred from 97% identity to amc:MADE_00068)

Predicted SEED Role

"Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 2.8.1.1)

MetaCyc Pathways

thiosulfate disproportionation IV (rhodanese) (1/1 steps found)
sulfide oxidation IV (mitochondria) (2/5 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (103 amino acids)

>MIT1002_00065 Thiosulfate sulfurtransferase GlpE (Alteromonas macleodii MIT1002)
MTTFSHISVNDVANFQGDVTIVDIRDPQSFANGHMPNAAQLNNDNFAAFIDQTPKDIPVV
VVCYHGVSSQQAAQVIAQQGFETVYSMDGGFEAWRLANPVVTA