Protein Info for MIT1002_00057 in Alteromonas macleodii MIT1002

Annotation: Formamidopyrimidine-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF01149: Fapy_DNA_glyco" amino acids 1 to 114 (114 residues), 123.7 bits, see alignment E=9.2e-40 TIGR00577: DNA-formamidopyrimidine glycosylase" amino acids 1 to 268 (268 residues), 309.4 bits, see alignment E=1.1e-96 PF06831: H2TH" amino acids 129 to 219 (91 residues), 93.8 bits, see alignment E=7.8e-31 PF06827: zf-FPG_IleRS" amino acids 241 to 268 (28 residues), 39.8 bits, see alignment (E = 4.7e-14)

Best Hits

Swiss-Prot: 94% identical to FPG_ALTMD: Formamidopyrimidine-DNA glycosylase (mutM) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K10563, formamidopyrimidine-DNA glycosylase [EC: 3.2.2.23 4.2.99.18] (inferred from 94% identity to amc:MADE_00058)

Predicted SEED Role

"Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)" in subsystem DNA Repair Base Excision (EC 3.2.2.23)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 3.2.2.23 or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>MIT1002_00057 Formamidopyrimidine-DNA glycosylase (Alteromonas macleodii MIT1002)
MPELPEVEVSRLGVSPHLIGNTITQVVVRERRMRWPIPQEVANVEGQSVIAVKRRAKYLL
IETAKGTLILHLGMSGKLRVIDASTPIIKHDHVDIVLNTGKCLRFNDPRRFGAVLFQAPD
MQIAMLDNLGPEPLTDDFDDKRLFKLSRNRKGPVKNFIMDNAIVVGVGNIYANEALFLAG
IDPRRAAGNISAARYQSLTATIKQVLAKAIEQGGTTLKDFAQTDGKPGYFAQHLNVYGRK
GEPCEVCGKAIESKVIGQRNTFFCTHCQR