Protein Info for MIT1002_00027 in Alteromonas macleodii MIT1002

Annotation: Outer membrane protein W precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13505: OMP_b-brl" amino acids 9 to 226 (218 residues), 52 bits, see alignment E=2.6e-17 PF03922: OmpW" amino acids 26 to 226 (201 residues), 211 bits, see alignment E=4.3e-66 PF05736: OprF" amino acids 59 to 180 (122 residues), 27.5 bits, see alignment E=6.2e-10 PF02462: Opacity" amino acids 121 to 193 (73 residues), 22.6 bits, see alignment E=2.4e-08

Best Hits

Swiss-Prot: 47% identical to OMPW_VIBCH: Outer membrane protein W (ompW) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07275, outer membrane protein (inferred from 96% identity to amc:MADE_00029)

Predicted SEED Role

"Outer membrane protein W precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>MIT1002_00027 Outer membrane protein W precursor (Alteromonas macleodii MIT1002)
MRKHFFSASALCFTLAALSPLASAHQQGDWIVRGGLTTVAPDESTSNIVAGGTDLGVALN
IDNDTQLGLNVAYFITDNINIELLAATPFKHDVNFSVADPLGTGNQLGEVTHLPPTLTAN
YYFNDASSAFQPYIGAGINYTFIFDEEFTGANETAGLSDLSLDNSFGLSAQVGMDYQIDT
KWHVNASVRFIDIDTEATFKVGDAAGKVSDIEIDPWVYTLSVGYTF