Protein Info for MIT1002_00026 in Alteromonas macleodii MIT1002

Annotation: Coproporphyrinogen-III oxidase, aerobic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF01218: Coprogen_oxidas" amino acids 18 to 310 (293 residues), 450.5 bits, see alignment E=8.6e-140

Best Hits

Swiss-Prot: 77% identical to HEM6_AERHH: Oxygen-dependent coproporphyrinogen-III oxidase (hemF) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K00228, coproporphyrinogen III oxidase [EC: 1.3.3.3] (inferred from 98% identity to amc:MADE_00028)

MetaCyc: 76% identical to coproporphyrinogen III oxidase (Escherichia coli K-12 substr. MG1655)
Coproporphyrinogen oxidase. [EC: 1.3.3.3]

Predicted SEED Role

"Coproporphyrinogen III oxidase, aerobic (EC 1.3.3.3)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>MIT1002_00026 Coproporphyrinogen-III oxidase, aerobic (Alteromonas macleodii MIT1002)
MTSAELLDGKNAAEVIEQVKSYLLGLQDTICQTLELADGKGQFVEDSWQREEGGGGRSRV
LKNGAVIEQGGVNFSHVFGSQMPASATANRPELAGRNFQAMGVSLVIHPHNPYIPTSHAN
VRFFIAEKEGEAPIWWFGGGFDLTPFYPFKDDVLHWHDTAKKLCKPFGNDVYPKYKKWCD
DYFYLKHRNETRGVGGLFFDDLNEWGFEQSFAFMQAVGNGFIDAYVPIVERRKQTDFGER
ERDFQLYRRGRYVEFNLVFDRGTLFGLQTGGRTESILMSMPPLARWEYCYTPAPGSAEAK
LTDWLKPTDW