Protein Info for MCAODC_27770 in Escherichia coli ECRC101
Name: phoB
Annotation: phosphate response regulator transcription factor PhoB
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PHOB_ECO57: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Escherichia coli O157:H7
KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 100% identity to eco:b0399)Predicted SEED Role
"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (229 amino acids)
>MCAODC_27770 phosphate response regulator transcription factor PhoB (Escherichia coli ECRC101) MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS GIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM RRISPMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLL NHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTGYRFSTRF