Protein Info for MCAODC_27260 in Escherichia coli ECRC101

Name: sunT
Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 transmembrane" amino acids 162 to 184 (23 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 381 to 405 (25 residues), see Phobius details amino acids 413 to 422 (10 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 10 to 701 (692 residues), 835.1 bits, see alignment E=2.2e-255 PF00664: ABC_membrane" amino acids 162 to 423 (262 residues), 105.5 bits, see alignment E=6.3e-34 PF00005: ABC_tran" amino acids 497 to 641 (145 residues), 92.6 bits, see alignment E=5.4e-30

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to etw:ECSP_0558)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (720 amino acids)

>MCAODC_27260 type I secretion system permease/ATPase (Escherichia coli ECRC101)
MKKNAQSVEAWLEAMIAVARYYRLDFSQENVRATVNWERDSKREELLTDMARQLGMGLRL
VEFSADSLNPWRLPLIAVFDNQQIGVITRRDNHDNISVQFSGDEGLETTLNVADIEDKIV
ELALLRPLSAIPDARVDDYIRPYQANWFWSLSLKDWRRYGDIMLASLVANVLALAAMIFS
MQVYDRVVPAQSYPTLWVLFAGVMMAILFEFCMRMVRTHLSDVIGKRADLRISDRVFGHA
LRLKNNVRSKSTGSFISQIRELESVRELITSTTIGAVADLPFFLLFVFILWMIGGWLVLV
VLLALLLLVIPGLLVQRPLARLANEGMRESAVRNATLVEAVQSIEDIKLLRAEQRFQNQW
NHTNDVASSISMKQRFLTGLLLTWTQEVQSIVYVVVLLVGCFMVMNGDMTTGALVGTTIL
ASRTIAPLSQISGVLSRWQQAKVARNGLDELMKRPVDQPEHGKLVHKAVLHGNYQFSNAV
FYYDEEEKIADVAIGKLNIQAGEKIAILGRNGAGKSTLLQMLAGMRIAQQGQVLLDNISI
GQLDPADLRRDMGLLSQTGRLFFGSLRENLTMGMPEASDEDIERALTLSGALPFVQKQKN
GLNYMIQEGGFGLSGGQRQTLLLARLLISQPNIVLLDEPSASLDEMAEAYLIEQLKQWIG
HRTLIIATHRTAMLQLVDRIIVMDQGRIVMDGAKEAILREQGEPTARRVVLQEKNKGSAA