Protein Info for MCAODC_26560 in Escherichia coli ECRC101
Name: nadD
Annotation: nicotinate-nucleotide adenylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to NADD_ECO5E: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Escherichia coli O157:H7 (strain EC4115 / EHEC)
KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to eco:b0639)MetaCyc: 100% identical to nicotinate-nucleotide adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide adenylyltransferase. [EC: 2.7.7.18]
Predicted SEED Role
"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)
MetaCyc Pathways
- aspartate superpathway (24/25 steps found)
- NAD de novo biosynthesis I (5/6 steps found)
- NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
- NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
- NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (3/4 steps found)
- NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
- NAD de novo biosynthesis III (4/6 steps found)
- NAD salvage pathway V (PNC V cycle) (3/5 steps found)
- NAD salvage (plants) (5/11 steps found)
- superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)
- NAD de novo biosynthesis II (from tryptophan) (3/9 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.18
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (213 amino acids)
>MCAODC_26560 nicotinate-nucleotide adenylyltransferase (Escherichia coli ECRC101) MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPEANSVQRKHML ELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAFIIGQDSLLTFPTWYEY ETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHLQPAGKIYLAETPWFNIS ATIIRERLQNGESCDDLLPEPVLTYINQQGLYR