Protein Info for MCAODC_23010 in Escherichia coli ECRC101

Name: flgG
Annotation: flagellar basal-body rod protein FlgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 136 (133 residues), 164.9 bits, see alignment E=4.2e-52 amino acids 145 to 243 (99 residues), 101.1 bits, see alignment E=1.1e-32 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 4 to 259 (256 residues), 388.1 bits, see alignment E=2e-120 PF00460: Flg_bb_rod" amino acids 7 to 35 (29 residues), 37.6 bits, see alignment (E = 1.7e-13) PF06429: Flg_bbr_C" amino acids 183 to 260 (78 residues), 96.5 bits, see alignment E=7.7e-32

Best Hits

Swiss-Prot: 100% identical to FLGG_ECO57: Flagellar basal-body rod protein FlgG (flgG) from Escherichia coli O157:H7

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 100% identity to eco:b1078)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>MCAODC_23010 flagellar basal-body rod protein FlgG (Escherichia coli ECRC101)
MISSLWIAKTGLDAQQTNMDVIANNLANVSTNGFKRQRAVFEDLLYQTIRQPGAQSSEQT
TLPSGLQIGTGVRPVATERLHSQGNLSQTNNSKDVAIKGQGFFQVMLPDGSSAYTRDGSF
QVDQNGQLVTAGGFQVQPAITIPANALSITIGRDGVVSVTQQGQAAPVQVGQLNLTTFMN
DTGLESIGENLYTETQSSGAPNESTPGLNGAGLLYQGYVETSNVNVAEELVNMIQVQRAY
EINSKAVSTTDQMLQKLTQL