Protein Info for MCAODC_18640 in Escherichia coli ECRC101

Name: ydjG
Annotation: NADH-dependent methylglyoxal reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00248: Aldo_ket_red" amino acids 15 to 320 (306 residues), 225.8 bits, see alignment E=3.1e-71

Best Hits

Swiss-Prot: 98% identical to AKRMG_ECOLI: NADH-specific methylglyoxal reductase (ydjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eok:G2583_2218)

MetaCyc: 98% identical to NADH-dependent methylglyoxal reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Hypothetical oxidoreductase YdjG (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>MCAODC_18640 NADH-dependent methylglyoxal reductase (Escherichia coli ECRC101)
MKKIPLGTTDITLSRMGLGTWAIGGGPAWNGDLDRQICIDTILEAHRCGINLIDTAPGYN
FGNSEVIVGQALKKLPREQVVVETKCGIVWERKGSLFNKVGDRQLYKNLSPESIREEVEA
SLQRLGFDYIDIYMTHWQSVPPFYTPIAETVAVLNELKAEGKIRAIGAANVDADHIREYL
QYGELDIIQAKYSILDRAMENELLPLCRDNGIVVQVYSPLEQGLLTGTITRDYVPGGARA
NKVWFQRENMLKVIDMLEQWQPLCARYQCTIPTLALAWILKQSDLISILSGATAPEQVRE
NVAALNINLSDADATLMREMAEVLGR