Protein Info for MCAODC_18615 in Escherichia coli ECRC101

Name: ydjE
Annotation: Inner membrane metabolite transport protein YdjE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 1 to 384 (384 residues), 116.5 bits, see alignment E=1.5e-37 PF07690: MFS_1" amino acids 1 to 337 (337 residues), 121.1 bits, see alignment E=5.3e-39

Best Hits

Swiss-Prot: 100% identical to YDJE_ECOLI: Inner membrane metabolite transport protein YdjE (ydjE) from Escherichia coli (strain K12)

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 100% identity to eco:b1769)

Predicted SEED Role

"Putative transport protein YdjK, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>MCAODC_18615 Inner membrane metabolite transport protein YdjE (Escherichia coli ECRC101)
MFGYFIGSLTGGFIGDYFGRRRAFRINLLIVGIAATGAAFVPDMYWLIFFRFLMGTGMGA
LIMVGYASFTEFIPATVRGKWSARLSFVGNWSPMLSAAIGVVVIAFFSWRIMFLLGGIGI
LLAWFLSGKYFIESPRWLAGKGQIAGAECQLREVEQQIEREKSIRLPPLTSYQSNSKVKV
IKGTFWLLFKGEMLRRTLVAITVLIAMNISLYTITVWIPTIFVNSGIDVDKSILMTAVIM
IGAPVGIFIAALIIDHFPRRLFGSTLLIIIAVLGYIYSIQTTEWAILIYGLVMIFFLYMY
VCFASAVYIPELWPTHLRLRGSGFVNAVGRIVAVFTPYGVAALLTHYGSITVFMVLGVML
LLCALVLSIFGIETRKVSLEEISEVN