Protein Info for MCAODC_18210 in Escherichia coli ECRC101

Name: ydiB
Annotation: quinate/shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF08501: Shikimate_dh_N" amino acids 12 to 94 (83 residues), 96.1 bits, see alignment E=1.2e-31 PF18317: SDH_C" amino acids 255 to 283 (29 residues), 44.4 bits, see alignment (E = 1.1e-15)

Best Hits

Swiss-Prot: 100% identical to YDIB_ECO5E: Quinate/shikimate dehydrogenase (ydiB) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K05887, quinate/shikimate dehydrogenase [EC: 1.1.1.282] (inferred from 99% identity to eco:b1692)

MetaCyc: 99% identical to quinate/shikimate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Quinate/shikimate dehydrogenase. [EC: 1.1.1.282]; 1.1.1.282 [EC: 1.1.1.282]

Predicted SEED Role

"Shikimate/quinate 5-dehydrogenase I beta (EC 1.1.1.282)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 1.1.1.282)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.282

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>MCAODC_18210 quinate/shikimate dehydrogenase (Escherichia coli ECRC101)
MDVTAKYELIGLMAYPIRHSLSPEMQNKALEKAGLPFTYMAFEVDNDSFPGAIEGLKALK
MRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVNDDGYLRGYNTDGTGHIRAIKESGF
DIKGKTMVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDKFFDKALAFAQRVNENTDCVVT
VTDLADQQAFAEALASADILTNGTKVGMKPLENKSLVNDISLLHPGLLVTECVYNPHMTK
LLQQAQQAGCKTIDGYGMLLWQGAEQFTLWTGKDFPLEYVKQVMGFGA