Protein Info for MCAODC_15985 in Escherichia coli ECRC101

Name: wcaG
Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF01370: Epimerase" amino acids 4 to 117 (114 residues), 25.6 bits, see alignment E=1.2e-09 PF05368: NmrA" amino acids 4 to 100 (97 residues), 32.9 bits, see alignment E=6.8e-12 PF13460: NAD_binding_10" amino acids 8 to 189 (182 residues), 179.4 bits, see alignment E=1e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to eok:G2583_1674)

Predicted SEED Role

"Oxidoreductase (putative)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>MCAODC_15985 NAD-dependent dehydratase (Escherichia coli ECRC101)
MKNVLILGAGGQIARHVINQLADKQTIKQTLFARQPAKIHKPYPTNSQIIMGDVLNHAAL
KQAMQGQDIVYANLTGEDLDIQANSVIAAMKACDVKRLIFVLSLGIYDEVPGKFGEWNNA
VIGEPLKPFRRAADAIEASGLEYTILRPAWLTDEDIIDYELTSRNEPFKGTIVSPKSVAA
LITDIIDKPEKHIGENIGINQPGTDGDKPFFM