Protein Info for MCAODC_15845 in Escherichia coli ECRC101

Name: puuB
Annotation: gamma-glutamylputrescine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01946: Thi4
  • amino acids 19 to 75 (57 residues), 28.7 bits, 2.4e-10
• PF01494: FAD_binding_3
  • amino acids 28 to 59 (32 residues), 24.5 bits, see alignment (E = 4.7e-09)
• PF00890: FAD_binding_2
  • amino acids 29 to 59 (31 residues), 20.8 bits, see alignment (E = 6e-08)
• PF01266: DAO
  • amino acids 29 to 381 (353 residues), 248.6 bits, E=4.1e-77
• PF13450: NAD_binding_8
  • amino acids 32 to 65 (34 residues), 23.3 bits, 1.9e-08

Best Hits

Swiss-Prot: 99% identical to PUUB_ECOLI: Gamma-glutamylputrescine oxidoreductase (puuB) from Escherichia coli (strain K12)

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 100% identity to eok:G2583_1648)

MetaCyc: 99% identical to gamma-glutamylputrescine oxidase (Escherichia coli K-12 substr. MG1655)
1.4.3.M3 [EC: 1.4.3.M3]

Predicted SEED Role

"Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)"

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (13/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (11/11 steps found)
• superpathway of ornithine degradation (8/8 steps found)
• putrescine degradation II (4/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.- or 1.4.3.M3

Protein Sequence (426 amino acids)

>MCAODC_15845 gamma-glutamylputrescine oxidase (Escherichia coli ECRC101)
MTEHTSSYYAASANKYAPFDTLNESISCDVCVVGGGYTGLSSALHLAEAGFDVVVLEASR
IGFGASGRNGGQLVNSYSRDIDVIEKSYGMDTARMLGSMMFEGGEIIRERIKRYQIDCDY
RPGGLFVAMNDKQLATLEEQKENWERYGNKQLEMLDANAIRREVASDRYTGALLDHSGGH
IHPLNLAIGEADAIRLNGGRVYELSAVTQIQHTTPAVVRTATGQVTAKYVIVAGNAYLGD
KVEPELAKRSMPCGTQVITTERLSDDLARSLIPKNYCVEDCNYLLDYYRLTADNRLLYGG
GVVYGARDPDDVERLVVPKLLKTFPQLKGVKIDYRWTGNFLLTLSRMPQFGRLDTNIYYM
QGYSGHGVTCTHLAGRLIAELLRGDAERFDAFANLPHYPFPGGRTLRVPFTAMGAAYYSL
RDRLGV