Protein Info for MCAODC_15345 in Escherichia coli ECRC101

Name: ehxB
Annotation: enterohemolysin T1SS ABC transporter permease/ATPase EhxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 transmembrane" amino acids 153 to 176 (24 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 388 to 417 (30 residues), see Phobius details TIGR01846: type I secretion system ATPase" amino acids 11 to 705 (695 residues), 1089.1 bits, see alignment E=0 PF03412: Peptidase_C39" amino acids 11 to 129 (119 residues), 78.3 bits, see alignment E=7.3e-26 PF00664: ABC_membrane" amino acids 157 to 424 (268 residues), 212.7 bits, see alignment E=1.3e-66 PF00005: ABC_tran" amino acids 485 to 634 (150 residues), 116.7 bits, see alignment E=1.9e-37

Best Hits

Swiss-Prot: 100% identical to HLYB_ECO57: Alpha-hemolysin translocation ATP-binding protein HlyB (hlyB) from Escherichia coli O157:H7

KEGG orthology group: K11004, ATP-binding cassette, subfamily B, bacterial HlyB/CyaB (inferred from 100% identity to ecf:ECH74115_B0019)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (706 amino acids)

>MCAODC_15345 enterohemolysin T1SS ABC transporter permease/ATPase EhxB (Escherichia coli ECRC101)
MMSKCSSHNSLYALILLAQYHNITVNAETIRHQYNTHTQDFGVTEWLLAAKSIGLKAKYV
EKHFSRLSIISLPALIWRDDGKHYILSRITKDSSRYLVYDPEQHQSLTFSRDEFEKLYQG
KVILVTSRATVVGELAKFDFSWFIPSVVKYRRILLEVLTVSAFIQFLALITPLFFQVVMD
KVLVHRGFSTLNIITIAFIIVILFEVILTGARTYIFSHTTSRIDVELGAKLFRHLLALPV
SYFENRRVGETVARVRELEQIRNFLTGQALTSVLDLFFSVIFFCVMWYYSPQLTLVILLS
LPCYVIWSLFISPLLRRRLDDKFLRNAENQAFLVETVTAINTIKSMAVSPQMIATWDKQL
AGYVASSFRVNLVAMTGQQGIQLIQKSVMVISLWMGAHLVISGEISIGQLIAFNMLAGQV
IAPVIRLAHLWQDFQQVGISVERLGDVLNTPVEKKSGRNILPEIQGDIEFKNVRFRYSSD
GNVILNNINLYISKGDVIGIVGRSGSGKSTLTKLLQRFYIPETGQILIDGHDLSLADPEW
LRRQIGVVLQENILLNRSIIDNITLASPAVSMEQAIEAARLAGAHDFIRELKEGYNTIVG
EQGVGLSGGQRQRIAIARALVTNPRILIFDEATSALDYESENIIMKNMSRICKNRTVIII
AHRLSTVKNANRIIVMDNGFISEDGTHKELISKKDSLYAYLYQLQA