Protein Info for MCAODC_12420 in Escherichia coli ECRC101

Name: hyfC
Annotation: hydrogenase 4 subunit HyfC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00146: NADHdh
  • amino acids 18 to 312 (295 residues), 196.5 bits, E=3.5e-62

Best Hits

Swiss-Prot: 99% identical to HYFC_ECOLI: Hydrogenase-4 component C (hyfC) from Escherichia coli (strain K12)

KEGG orthology group: K12138, hydrogenase-4 component C [EC: 1.-.-.-] (inferred from 99% identity to eco:b2483)

MetaCyc: 52% identical to hydrogenase 3 membrane subunit HycD (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]

Predicted SEED Role

"Hydrogenase-4 component C"

MetaCyc Pathways

• mixed acid fermentation (16/16 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production V (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (3/6 steps found)
• L-glutamate degradation VII (to butanoate) (7/12 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Glyoxylate and dicarboxylate metabolism
• Insect hormone biosynthesis
• Methane metabolism
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.12.7.2

Protein Sequence (315 amino acids)

>MCAODC_12420 hydrogenase 4 subunit HyfC (Escherichia coli ECRC101)
MRQTLCDGYLVIFALAQAVILLMLTPLFTGISRQIRARMHSRRGPGIWQDYRDIHKLFKR
QEVAPISSGLMFRLMPWVLISSMLVLAMALPLFITVSPFAGGGDLITLIYLLALFRFFFA
LSGLDTGSPFAGVGASRELTLGILVEPMLILSLLVLALIAGSTHIEMISNTLATGWNSPL
TTVLALLACGFACFIEMGKIPFDVAEAEQELQEGPLTEYSGAGLALAKWGLGLKQVVMAA
LFVALFLPFGCAQELSLACLLTSLVVTLLKVLLIFVLASIAENTLARGRFLLIHHVTWLG
FSLAALAWVFWLTGL