Protein Info for MCAODC_10440 in Escherichia coli ECRC101

Name: yqeF
Annotation: putative acetyl-CoA acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00108: Thiolase_N" amino acids 4 to 261 (258 residues), 346.2 bits, see alignment E=1.7e-107 TIGR01930: acetyl-CoA C-acyltransferase" amino acids 6 to 390 (385 residues), 467.2 bits, see alignment E=2e-144 PF00109: ketoacyl-synt" amino acids 81 to 119 (39 residues), 28.8 bits, see alignment 1.4e-10 PF02803: Thiolase_C" amino acids 270 to 391 (122 residues), 178.9 bits, see alignment E=4.1e-57

Best Hits

Swiss-Prot: 100% identical to YQEF_ECOLI: Probable acetyl-CoA acetyltransferase (yqeF) from Escherichia coli (strain K12)

KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 100% identity to eco:b2844)

MetaCyc: 66% identical to acetyl-CoA C-acetyltransferase (Pseudomonas simiae)
Acetyl-CoA C-acyltransferase. [EC: 2.3.1.16, 2.3.1.9]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.16, 2.3.1.9

Use Curated BLAST to search for 2.3.1.16 or 2.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>MCAODC_10440 putative acetyl-CoA acetyltransferase (Escherichia coli ECRC101)
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMTQSNGQTLVVDTDEQPHTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE