Protein Info for MCAODC_08085 in Escherichia coli ECRC101

Name: aroE
Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00507: shikimate dehydrogenase
  • amino acids 3 to 270 (268 residues), 370.4 bits, E=2.2e-115
• PF08501: Shikimate_dh_N
  • amino acids 6 to 88 (83 residues), 83.8 bits, E=1.3e-27
• PF01488: Shikimate_DH
  • amino acids 121 to 190 (70 residues), 37.8 bits, E=3e-13
• PF18317: SDH_C
  • amino acids 237 to 267 (31 residues), 38.2 bits, 1.4e-13

Best Hits

Swiss-Prot: 100% identical to AROE_ECO57: Shikimate dehydrogenase (NADP(+)) (aroE) from Escherichia coli O157:H7

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 100% identity to ecf:ECH74115_4604)

MetaCyc: 98% identical to shikimate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Shikimate dehydrogenase. [EC: 1.1.1.25]

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Protein Sequence (272 amino acids)

>MCAODC_08085 shikimate dehydrogenase (Escherichia coli ECRC101)
METYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFVNTLNAFFSAGGKGANV
TVPFKEEAFARADELTERAALAGAVNTLKRLEDGRLLGDNTDGVGLLSDLERLSFIRPGL
RILLIGAGGASRGVLLPLLSLDCAVTITNRTVSRAEELAKLFAHTGSIQALGMDELEGHE
FDLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKPTADGLGM
LVAQAAHAFLLWHGVLPDVEPVIKQLQEELSA