Protein Info for MCAODC_06175 in Escherichia coli ECRC101

Name: waaO
Annotation: lipopolysaccharide 3-alpha-galactosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF01501: Glyco_transf_8" amino acids 29 to 275 (247 residues), 247.6 bits, see alignment E=1.5e-77 PF08437: Glyco_transf_8C" amino acids 277 to 333 (57 residues), 74.3 bits, see alignment E=6.4e-25

Best Hits

Swiss-Prot: 60% identical to RFAI_SALTY: Lipopolysaccharide 1,3-galactosyltransferase (rfaI) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03275, UDP-glucose:(glucosyl)LPS alpha-1,3-glucosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to sfv:SFV_3902)

MetaCyc: 60% identical to lipopolysaccharide 1,3-galactosyltransferase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Lipopolysaccharide 3-alpha-galactosyltransferase. [EC: 2.4.1.44]

Predicted SEED Role

"UDP-glucose:(glucosyl)lipopolysaccharide alpha-1,3-glucosyltransferase WaaO (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>MCAODC_06175 lipopolysaccharide 3-alpha-galactosyltransferase (Escherichia coli ECRC101)
MSQLNDSDIILFEYNFHYQNIRSKNTLDIAFGIDRNFLFGCGVAIASILLNNREISCEFH
VFTDYISDKDKLYFSDLAKQYNSRINIYVINCDKLKSLPSTKNWTYATYFRFIIADYFYH
KHEKILYLDADIACKGSIKELLDYQFSTNEIAAVVAERDVEWWQNRASVLTTPQLASGYF
NAGFLLINIDEWNLNNISSKAIEMLRDPDWVSKITHLDQDVLNVLLNGKVKFISEKYNTR
YSINYELKDKVDNPVNDDTVFIHYVGPTKPWHEWADYPVSRSFLIAKAASPWSKEDLLKP
VNSNQYRYCAKHKFKQKHYMAGIFNYLKYYKEKCF